線上CFD交易 | 交易市場 | Plus500

  • 2022-01-07Tarehe ya ukusanyaji
  • 2022-02-15Imesasishwa
線上CFD交易 | 交易市場 | Plus500
  • Anwani ya wavuti:www.plus500.com
  • IP ya Seva:152.195.55.222
  • Maelezo ya tovuti:英國、德國和西班牙最大的CFD供應商。交易全球最熱門的市場:外匯、加密數位貨幣、股票、商品、指數、ETF和期權的CFD。

jina la kikoa:www.plus500.comUthamini

kuhusu 5000~500000

jina la kikoa:www.plus500.commtiririko

534

jina la kikoa:www.plus500.comNzuri au mbaya

Bila hekima. ngumu kufanikiwa mkali

tovuti:線上CFD交易 | 交易市場 | Plus500Uzito

3

tovuti:線上CFD交易 | 交易市場 | Plus500IP

152.195.55.222

tovuti:線上CFD交易 | 交易市場 | Plus500yaliyomo

OnlineCFDTrading|TradingtheMarkets|Plus500functiondeleteCookie(name,domain,path){document.cookie=name+"=;expires=Thu,01Jan197000:00:00GMT;path="+path+";domain="+domain;}functiondisableGoogleAnalytics(disable){window['ga-disable-UA--19']=disable;if(disable){varcookiesDomain="localhost";if(window.location.host.lastIndexOf("localhost",0)!==0){cookiesDomain="."+window.location.host.split(".").slice(1).join(".");}deleteCookie("_ga",cookiesDomain,'/')deleteCookie("_gid",cookiesDomain,'/')deleteCookie("_gat_UA--19",cookiesDomain,'/')}}if(window.localStore["Disable3rdPartyAnalytics"]==="true"){disableGoogleAnalytics(true)}window.dataLayer=window.dataLayer||[];window.dataLayer.push({'customPePath':'/','urlCountry':'GB','langue':'en','IsInAppView':'false'});(function(w,d,s,l,i){w[l]=w[l]||[];w[l].push({'gtm.start':newDate().getTime(),event:'gtm.js'});varf=d.getElementsByTName(s)[0],j=d.createElement(s),dl=l!='dataLayer'?'&l='+l:'';j.async=true;j.src='/gtm.js?id='+i+dl;f.parentNode.insertBefore(j,f);})(window,document,'script','dataLayer','GTM-RQS5');Plus500doesnotprovideCFDservicestoresidentsofUnitedStates.Plus500doesnotprovideCFDservicestoresidentsofUnitedStates.74%ofretailCFDaccountslosemoney.Plus500logoinsidehomepelinkMarketsBackIndicesForexCommoditiesSharesOptionsETFsAllInstrumentsTradingBackPremiumServiceProfessionalTradingFees&ChargesEducation&InsightsTradingAcademyEconomicCalendarRiskManementAlertsNews&MarketInsightsCompanyBackAboutUsAffiliatesInvestorRelationsCookiesandPrivacySponsorshipsLegiaWarsawSponsorshipAtalantaB.C.SponsorshipBSCYoungBoysSponsorshipLoginenBackČeskyDanskDeutschEestiEspa241;olEλληνικάFran231;aisHrvatski237;slenskaItalianoLatviešuLietuviškaiMyarNederlandsNorskPolskiPortugu234;sPyccĸийRom226;năSlovenčinaSlovenskiSuomeksiSvenskaT252;rk231;eбългарскиעבריתالعربية简体中文繁體中文MenuStartTradingSearch{{toCategoryName(category)}}Trade{{r.name}}TradeNoresultsfound...ContactUsIT'STRADINGwithaPlusCFDsonSharesIndicesForexCommoditiesStartTradingNowTryFreeDemoJoinover22milliontradersworldwidewhohealreadychosenPlus500Sinceinception$800+BillionTradedValue2800*Instruments22+MillionRegisteredCustomers300+MillionPositionsOpened50+Countries*Instrumentailabilityissubjecttojurisdiction.AworldofopportunitieswithGlobalMarketsDiscoverthousandsofCFDsontheworld’smostpopularfinancialinstrumentsandgetfreereal-timequotestoexploreendlesstradingopportunities.{{activeCategoryName}}{{instrument.name}}{{instrument.price?instrument.price.toFixed(instrument.precision):'--'}}{{instrument.changeRate.toFixed(percentPrecision)}}%TradevarfeedApp;varinitialData={"MostPopular":{"categoryName":"MostPopular","instruments":[{"instrumentId":4,"precision":5,"threshold":"0.5","name":"GBP/USD","instrumentLink":"/en/Instruments/GBPUSD","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":1.,"changeRate":0.05},{"instrumentId":28,"precision":3,"threshold":"0.5","name":"GBP/JPY","instrumentLink":"/en/Instruments/GBPJPY","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":163.050,"changeRate":-0.01},{"instrumentId":10,"precision":2,"threshold":"2.0","name":"Oil","instrumentLink":"/en/Instruments/CL","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":90.44,"changeRate":-0.33},{"instrumentId":11,"precision":2,"threshold":"2.0","name":"Gold","instrumentLink":"/en/Instruments/XAU","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":1788.65,"changeRate":0.0},{"instrumentId":,"precision":2,"threshold":"40.0","name":"Gold|Put1770","instrumentLink":"/en/Instruments/OGSEP22P1770","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":12.38,"changeRate":-0.74},{"instrumentId":7814,"precision":2,"threshold":"1.0","name":"NFTGiantsIndex","instrumentLink":"/en/Instruments/BNFTGI","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":843.62,"changeRate":1.38},{"instrumentId":2,"precision":5,"threshold":"0.5","name":"EUR/USD","instrumentLink":"/en/Instruments/EURUSD","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":1.,"changeRate":0.03},{"instrumentId":,"precision":2,"threshold":"40.0","name":"Oil|Call91.5","instrumentLink":"/en/Instruments/CLSEP22C91.5","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":2.12,"changeRate":-0.69}],"icon":"cdn-main.plus500.com/1.0.0./Resources/Imes/newhome/svg/feeds-icons/feeds-widget-icon-mostpopular.svg"},"Stocks":{"categoryName":"Shares","instruments":[{"instrumentId":2220,"precision":2,"threshold":"4.0","name":"Take-TwoInteractiveSoftware","instrumentLink":"/en/Instruments/TTWO","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":125.00,"changeRate":-1.3},{"instrumentId":4648,"precision":2,"threshold":"4.0","name":"PalantirTechnologies","instrumentLink":"/en/Instruments/PLTR","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":9.77,"changeRate":-14.16},{"instrumentId":4936,"precision":2,"threshold":"4.0","name":"Coinbase","instrumentLink":"/en/Instruments/COIN","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":97.37,"changeRate":5.33},{"instrumentId":2033,"precision":2,"threshold":"4.0","name":"Tesla","instrumentLink":"/en/Instruments/TSLA","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":867.94,"changeRate":0.77},{"instrumentId":6,"precision":2,"threshold":"4.0","name":"Alphabet","instrumentLink":"/en/Instruments/GOOG","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":117.70,"changeRate":-0.06},{"instrumentId":92,"precision":2,"threshold":"4.0","name":"Amazon","instrumentLink":"/en/Instruments/AMZN","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":138.88,"changeRate":-0.99},{"instrumentId":3909,"precision":2,"threshold":"4.0","name":"NIO","instrumentLink":"/en/Instruments/NIO","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":20.08,"changeRate":-0.1},{"instrumentId":3848,"precision":2,"threshold":"4.0","name":"CanopyGrowth","instrumentLink":"/en/Instruments/CGC","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":3.26,"changeRate":21.3}],"icon":"cdn-main.plus500.com/1.0.0./Resources/Imes/newhome/svg/feeds-icons/feeds-widget-icon-stocks.svg"},"Commodities":{"categoryName":"Commodities","instruments":[{"instrumentId":10,"precision":2,"threshold":"2.0","name":"Oil","instrumentLink":"/en/Instruments/CL","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":90.44,"changeRate":-0.33},{"instrumentId":431,"precision":2,"threshold":"2.0","name":"BrentOil","instrumentLink":"/en/Instruments/EB","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":96.52,"changeRate":1.77},{"instrumentId":430,"precision":4,"threshold":"2.0","name":"HeatingOil","instrumentLink":"/en/Instruments/HO","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":3.1840,"changeRate":0.25},{"instrumentId":11,"precision":2,"threshold":"2.0","name":"Gold","instrumentLink":"/en/Instruments/XAU","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":1788.65,"changeRate":0.0},{"instrumentId":12,"precision":3,"threshold":"2.0","name":"Silver","instrumentLink":"/en/Instruments/X","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":20.689,"changeRate":0.19},{"instrumentId":4092,"precision":2,"threshold":"2.0","name":"LowSulphurGasoil","instrumentLink":"/en/Instruments/G","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":948.69,"changeRate":-3.9},{"instrumentId":115,"precision":2,"threshold":"2.0","name":"Coffee","instrumentLink":"/en/Instruments/KC","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":211.28,"changeRate":0.92},{"instrumentId":1461,"precision":2,"threshold":"2.0","name":"Palladium","instrumentLink":"/en/Instruments/PA","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":2213.38,"changeRate":-0.47}],"icon":"cdn-main.plus500.com/1.0.0./Resources/Imes/newhome/svg/feeds-icons/feeds-widget-icon-commodities.svg"},"Indices":{"categoryName":"Indices","instruments":[{"instrumentId":3869,"precision":2,"threshold":"1.0","name":"UK100","instrumentLink":"/en/Instruments/UK100","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":7431.25,"changeRate":0.52},{"instrumentId":98,"precision":0,"threshold":"1.0","name":"ASX200","instrumentLink":"/en/Instruments/SPI200","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":6914.0,"changeRate":-0.12},{"instrumentId":3017,"precision":2,"threshold":"1.0","name":"Germany40","instrumentLink":"/en/Instruments/FDAX","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":.81,"changeRate":0.6},{"instrumentId":4173,"precision":0,"threshold":"1.0","name":"Spain35","instrumentLink":"/en/Instruments/IBX","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":8258.0,"changeRate":1.29},{"instrumentId":85,"precision":0,"threshold":"1.0","name":"USA30-WallStreet","instrumentLink":"/en/Instruments/YM","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":.0,"changeRate":0.2},{"instrumentId":4310,"precision":2,"threshold":"1.0","name":"Netherlands25","instrumentLink":"/en/Instruments/FT","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":725.06,"changeRate":0.63},{"instrumentId":18,"precision":2,"threshold":"1.0","name":"USA500","instrumentLink":"/en/Instruments/ES","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":4151.78,"changeRate":0.25},{"instrumentId":295,"precision":0,"threshold":"1.0","name":"Italy40","instrumentLink":"/en/Instruments/FIBi","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":.0,"changeRate":0.43}],"icon":"cdn-main.plus500.com/1.0.0./Resources/Imes/newhome/svg/feeds-icons/feeds-widget-icon-indices.svg"},"Forex":{"categoryName":"Forex","instruments":[{"instrumentId":2,"precision":5,"threshold":"0.5","name":"EUR/USD","instrumentLink":"/en/Instruments/EURUSD","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":1.,"changeRate":0.03},{"instrumentId":5,"precision":5,"threshold":"0.5","name":"EUR/GBP","instrumentLink":"/en/Instruments/EURGBP","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":0.,"changeRate":-0.03},{"instrumentId":177,"precision":5,"threshold":"0.5","name":"EUR/AUD","instrumentLink":"/en/Instruments/EURAUD","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":1.,"changeRate":-0.94},{"instrumentId":376,"precision":5,"threshold":"0.5","name":"EUR/NZD","instrumentLink":"/en/Instruments/EURNZD","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":1.,"changeRate":-0.03},{"instrumentId":72,"precision":4,"threshold":"0.5","name":"EUR/CAD","instrumentLink":"/en/Instruments/EURCAD","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":1.3109,"changeRate":0.04},{"instrumentId":100,"precision":4,"threshold":"0.5","name":"EUR/CHF","instrumentLink":"/en/Instruments/EURCHF","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":0.9738,"changeRate":-0.57},{"instrumentId":4,"precision":5,"threshold":"0.5","name":"GBP/USD","instrumentLink":"/en/Instruments/GBPUSD","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":1.,"changeRate":0.05},{"instrumentId":39,"precision":5,"threshold":"0.5","name":"AUD/USD","instrumentLink":"/en/Instruments/AUDUSD","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":0.,"changeRate":0.01}],"icon":"cdn-main.plus500.com/1.0.0./Resources/Imes/newhome/svg/feeds-icons/feeds-widget-icon-forex.svg"},"Options":{"categoryName":"Options","instruments":[{"instrumentId":,"precision":2,"threshold":"40.0","name":"Gold|Call1800","instrumentLink":"/en/Instruments/OGSEP22C1800","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":19.75,"changeRate":-1.46},{"instrumentId":,"precision":2,"threshold":"40.0","name":"USA500|Put4170","instrumentLink":"/en/Instruments/EWAUG22P4170","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":80.50,"changeRate":-2.04},{"instrumentId":,"precision":2,"threshold":"40.0","name":"NASDAQ100|Call","instrumentLink":"/en/Instruments/NQAUG22C","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":189.56,"changeRate":-9.39},{"instrumentId":,"precision":2,"threshold":"40.0","name":"Netflix|Call245","instrumentLink":"/en/Instruments/NFLXAUG22C245","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":3.32,"changeRate":89.23},{"instrumentId":,"precision":3,"threshold":"40.0","name":"NaturalGas|Call7.9","instrumentLink":"/en/Instruments/NGSEP22C7.9","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":0.406,"changeRate":-34.42},{"instrumentId":,"precision":2,"threshold":"40.0","name":"Tesla|Put840","instrumentLink":"/en/Instruments/TSLAAUG22P840","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":19.56,"changeRate":-17.3},{"instrumentId":,"precision":2,"threshold":"40.0","name":"UK100|Put7300","instrumentLink":"/en/Instruments/FTSEAUG22P7300","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":22.99,"changeRate":-45.15},{"instrumentId":,"precision":2,"threshold":"40.0","name":"Apple|Put145","instrumentLink":"/en/Instruments/AAPLAUG22P145","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":0.10,"changeRate":-26.67}],"icon":"cdn-main.plus500.com/1.0.0./Resources/Imes/newhome/svg/feeds-icons/feeds-widget-icon-options.svg"},"ETFs":{"categoryName":"ETFs","instruments":[{"instrumentId":145,"precision":2,"threshold":"3.0","name":"USO-OilFund","instrumentLink":"/en/Instruments/USO","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":73.44,"changeRate":2.78},{"instrumentId":403,"precision":2,"threshold":"3.0","name":"iSharesSilver","instrumentLink":"/en/Instruments/SLV","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":19.00,"changeRate":3.82},{"instrumentId":148,"precision":2,"threshold":"3.0","name":"UNG-GasFund","instrumentLink":"/en/Instruments/UNG","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":26.25,"changeRate":-4.68},{"instrumentId":150,"precision":2,"threshold":"3.0","name":"OIH-OilService","instrumentLink":"/en/Instruments/OIH","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":225.78,"changeRate":0.5},{"instrumentId":144,"precision":2,"threshold":"3.0","name":"GLDGold","instrumentLink":"/en/Instruments/GLD","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":166.62,"changeRate":0.85},{"instrumentId":1349,"precision":2,"threshold":"3.0","name":"CommodityIndexFund","instrumentLink":"/en/Instruments/DBC","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":25.14,"changeRate":1.21},{"instrumentId":3519,"precision":2,"threshold":"3.0","name":"GlobalXLithium&BatteryTech","instrumentLink":"/en/Instruments/LIT","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":76.86,"changeRate":1.41},{"instrumentId":4202,"precision":2,"threshold":"3.0","name":"NUGT","instrumentLink":"/en/Instruments/NUGT","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":32.74,"changeRate":5.5}],"icon":"cdn-main.plus500.com/1.0.0./Resources/Imes/newhome/svg/feeds-icons/feeds-widget-icon-etfs.svg"},"RisersAndFallers":{"categoryName":"Risers&Fallers","instruments":[{"instrumentId":,"precision":2,"threshold":"40.0","name":"Netflix|Call240","instrumentLink":"/en/Instruments/NFLXAUG22C240","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":4.84,"changeRate":80.0},{"instrumentId":1072,"precision":2,"threshold":"4.0","name":"OZMinerals","instrumentLink":"/en/Instruments/OZL.CHA","isDelayedInstrument":true,"tradingLink":"/en/SiteNotailable","price":25.43,"changeRate":34.95},{"instrumentId":123,"precision":3,"threshold":"2.0","name":"NaturalGas","instrumentLink":"/en/Instruments/NG","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":7.653,"changeRate":0.9},{"instrumentId":3973,"precision":4,"threshold":"0.5","name":"CHF/HUF","instrumentLink":"/en/Instruments/CHFHUF","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":403.2770,"changeRate":0.81},{"instrumentId":,"precision":2,"threshold":"40.0","name":"Europe50|Put3550","instrumentLink":"/en/Instruments/OESXAUG22P3550","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":5.49,"changeRate":-54.47},{"instrumentId":4092,"precision":2,"threshold":"2.0","name":"LowSulphurGasoil","instrumentLink":"/en/Instruments/G","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":948.69,"changeRate":-3.9},{"instrumentId":177,"precision":5,"threshold":"0.5","name":"EUR/AUD","instrumentLink":"/en/Instruments/EURAUD","isDelayedInstrument":false,"tradingLink":"/en/SiteNotailable","price":1.,"changeRate":-0.94},{"instrumentId":3972,"precision":4,"threshold":"0.5","name":"EUR/ZAR","instrumentLink":"/en/Instruments/EURZAR","isDelayedInstrument":true,"tradingLink":"/en/SiteNotailable","price":16.9097,"changeRate":-0.64}],"icon":"cdn-main.plus500.com/1.0.0./Resources/Imes/newhome/svg/feeds-icons/feeds-widget-icon-risers-fallers.svg"}}document.addEventListener('DOMContentLoaded',function(){varoptions={rootElement:'#feedTable',initialData:initialData,apiUrl:'/en/api/LiveData/FeedsUpdates',priceDownClass:'red',priceUpClass:'green',percentUpClass:'inst-up',percentDownClass:'inst-down',thresholdClass:"highlight-threshold",updateInterval:3000,percentPrecision:2}if("IntersectionObserver"inwindow){varobserver=newwindow.IntersectionObserver(function(entries){varentry=entries[0]if(entry.isIntersecting){loadJS("cdn-main.plus500.com/1.0.0./Resources/Scripts/vue.min.js",document.body,function(){loadJS("cdn-main.plus500.com/1.0.0./Resources/Scripts/feedsApp.min.js",document.body,function(){feedApp=initFeedsApp(options)},true);},true)observer.unobserve(entry.target);}},{threshold:0.05,rootMargin:'20%'});observer.observe(document.querySelector(options.rootElement))}else{loadJS("cdn-main.plus500.com/1.0.0./Resources/Scripts/vue.min.js",document.body,function(){loadJS("cdn-main.plus500.com/1.0.0./Resources/Scripts/feedsApp.min.js",document.body,function(){feedApp=initFeedsApp(options)},true);},true)}});FastandreliableorderexecutionNocommissionsandtightspreadsAdvancedanalyticaltoolsLevereofupto1:30Real-timequotesFastandsecurewithdrawalsExploreMarketsMarketNewsProtected&secureYourdataissafeandyourfundsarekeptinsegregatedbankaccounts,inaccordancewithregulatoryrequirements.ProfessionalsupportGetaround-the-clockdedicatedcustomerserviceinmultiplelangues.RegulatedLicensedandregulatedbyavarietyofgloballeadingregulators.Learnmore.ReliablePlus500LtdisaFTSE250companylistedontheLondonStockExchange’sMainMarketforListedCompanies.*Plus500offersmultipleglobalpaymentmethods.InvestinginyourfouritestocksLearnMoreLeveredtrading,goinglongorshortStartTradingNowTradingthemostpopularU.S.Futures*ailableonlyintheU.S.TradeCFDsonPopularSharesBuyorSellCFDsonSharessuchasApple,Amazon,Tesla,andotherworld-leadingStockswithourinnovativetradingplatform.TradeSharesTradeCFDsonavarietyofCommoditiesBuyorSellCFDsonCommoditiessuchasOil,Gold,Silver,andothercommoditiesusingouradvancedtechnology.TradeCommoditiesTradeCFDsonyourfouriteForexpairsBuyorSellCFDsonForexpairssuchasEUR/USD,GBP/USD,EUR/GBP,andmoreusingoureconomiccalendartokeepuptodateonglobalevents.TradeForexTradeCFDsonIndicesfromaroundtheglobeBuyorSellCFDsonIndicessuchasS&P500(ES),NASDAQ100(NQ),FTSE100(UK100),andotherpopularindicesusingourfreereal-timequotes.TradeIndicesTradeSmarterPracticeyourstrategyTryourfreedemoaccountbeforeyouopenarealtradingaccounttoexploreourintuitivetradingplatformandenhanceyourskills.TrynowExpandyourknowledgeLearnabouttradingCFDswithPlus500usingourcomprehensiveeducationalmaterials.EnterTradingAcademyManeyourriskUseouradvancedriskmanementtoolstolimityourlossesandlockinprofits.ReadmoreWeSponsorATALANTAB.C.LEGIAWARSAWBSCYOUNGBOYSwindow.addEventListener('load',()=>{if("IntersectionObserver"inwindow){letoptions={threshold:0.5}letobserverCallback=function(entries){entries.filter(e=>e.isIntersecting).forEach(entry=>{letsectionName=entry.target.dataset.sectionName;sendAnalyticsEvent("HomepeSection","SectionVisible",sectionName)observer.unobserve(entry.target)})}letelements=document.querySelectorAll('section[data-section-name]');letobserver=newIntersectionObserver(observerCallback,options)elements.forEach(el=>observer.observe(el));}document.querySelectorAll("a[data-cta-name]").forEach(el=>{el.addEventListener('click',()=>{letctaName=el.dataset.ctaName;letsection=el.closest("section[data-section-name]")letsectionName=section?section.dataset.sectionName:"";sendAnalyticsEvent("HomepeCTAClick",ctaName,sectionName)});})letrtl=false;lettableWidget=document.querySelectorAll(".gs-regulatory-widget");letplusAnimation=(targetElement)=>{targetElement.forEach((element)=>{letplus=element.querySelectorAll(".plus-bg-small,.plus-bg-medium,.plus-bg-large"),tl=gsap.timeline().from(plus,{yPercent:150,duration:1,stger:.1,ease:"slow"})ScrollTrigger.create({trigger:element,start:"050%",end:"100%50%",animation:tl,scrub:1})})}leticonAnimation=(targetElement)=>{targetElement.forEach((element)=>{leticon=element.querySelectorAll(".item-icon"),tl=gsap.timeline().from(icon,{opacity:0,scale:0,duration:.5,stger:.1})ScrollTrigger.create({trigger:element,start:"-40%50%",end:"60%50%",animation:tl})})}ScrollTrigger.seStyles(".plus-bg-small,.plus-bg-medium,.plus-bg-large,.item-icon,.gs-regulatory-widget,.gs-trading-img-box,.sponsorships-item");ScrollTrigger.matchMedia({"(min-width:769px)":function(){//PlusAnimationletplusesTarget=document.querySelectorAll(".gs-anim-target")plusAnimation(plusesTarget);//IconsAnimationleticonsTarget=document.querySelectorAll(".items-icon-group")iconAnimation(iconsTarget);//TableWidgetAnimationgsap.timeline({scrollTrigger:{trigger:tableWidget,start:"-30%50%",end:"50%50%",once:true,}}).from(tableWidget,{opacity:0,xPercent:rtl?"-50":"50"});//IpadAnimationgsap.timeline({scrollTrigger:{trigger:".gs-trading-img-box",start:"-20%50%",end:"050%"}}).from(".gs-trading-img-box",{opacity:0,xPercent:100,duration:.5});//SponsorAnimationgsap.timeline({scrollTrigger:{trigger:".sponsorships-section",start:'20%50%',end:'70%50%',}}).from(".sponsorships-item[data-index='2']",{xPercent:rtl?"-40":"40",duration:.5}).from(".sponsorships-item[data-index='3']",{xPercent:rtl?"40":"-40",duration:.5},"=-.5");},"(max-width:768px)":function(){//IconsAnimationleticonsTarget=document.querySelectorAll(".item-box")iconAnimation(iconsTarget);//TableWidgetAnimationgsap.timeline({scrollTrigger:{trigger:tableWidget,start:"-80%50%",end:"20%50%"}}).from(tableWidget,{opacity:0,yPercent:50});},"all":function(){//IphoneAnimationgsap.timeline({scrollTrigger:{trigger:".gs-payment-section",start:"-25%50%",end:"10%50%"}}).from(".gs-payment-header-bg",{opacity:0,y:400,duration:.5});}});})NeedHelp?24/7SupportAboutUsNews&MarketInsightsClientMoneyProtectionRiskDisclosureNoticeTerms&reementsModernSleryStatementCookiePolicyCFDsarecomplexinstrumentsandcomewithahighriskoflosingmoneyrapidlyduetolevere.74%ofretailinvestoraccountslosemoneywhentradingCFDswiththisprovider.YoushouldconsiderwhetheryouunderstandhowCFDsworkandwhetheryoucanaffordtotakethehighriskoflosingyourmoney.Plus500ismainlycompensatedforitsservicesthroughtheBid/Askspread. CheckourFees&Charges.Theinformationonthiswebsiteisgeneralinnature.Pleaseconsidertheinformationinlightofyourobjectives,financialsituationandneeds.Plus500isatrademarkofPlus500Ltd.Plus500Ltdoperatesthroughthefollowingsubsidiaries:Plus500UKLtdisauthorisedandregulatedbytheFinancialConductAuthority(FRN ).CryptocurrencyCFDsarenotailabletoRetailClients.OfficeAddress:Plus500UKLtd,8AngelCourt,Copthallenue|LondonEC2R7HJ.Plus500CYLtdisauthorisedandregulatedbytheCyprusSecuritiesandExchangeCommission(Licence No. 250/14).CryptocurrencyCFDsarenotailabletoUKRetailClients.Plus500AUPtyLtdholdsAFSL #issuedbyASIC,FSPNo. issuedbytheFMAinNewZealandandAuthorisedFinancialServicesProvider #issuedbytheFSCAinSouthAfrica.Plus500SEYLtdisauthorisedandregulatedbytheSeychellesFinancialServicesAuthority(Licence No. SD039).Plus500EEASisauthorisedandregulatedbytheEstonianFinancialSupervisionandResolutionAuthority(LicenceNo. 4.1-1/18).Plus500SGPteLtd(UEN1Z)holdsacapitalmarketsserviceslicensefromtheMonetaryAuthorityofSingaporefordealingincapitalmarketsproducts(LicenseNo.CMS-1).Plus500ProSecuredBySSL. ©Plus500.Allrightsreserved.FollowUsOn:FacebookTwitterInstram24/7SupportPlus500usescookiestoimproveyourbrowsingexperience.Youcanclickacceptorcontinuebrowsingtoconsenttocookiesuse.ReadourCookiePolicytolearnmore.Acceptwindow.addEventListener("load",function(){loadJS("cdn-main.plus500.com/1.0.0./Resources/Scripts/foundation.min.js",document.body,function(){$(document).foundation();$(document).on("reInitFoundation",function(e){$(document).foundation();});});});window.addEventListener('load',()=>{gsap.registerPlugin(SplitText);consttargetSlogans=document.querySelectorAll('.main-banner-anim-item'),splitTextTimeline=newTimelineMax({repeat:-1});targetSlogans.forEach(targetSlogan=>{gsap.set(targetSlogan,{perspective:300});constisArabic=(document.documentElement.lang==="ar");letsplitType=isArabic?"words":"chars,words"letmySplitText=newSplitText(targetSlogan,{type:splitType,charsClass:"char"});letanimationType=isArabic?mySplitText.words:mySplitText.chars;splitTextTimeline.set(targetSlogan,{autoAlpha:1,display:"block"});splitTextTimeline.from(animationType,{duration:.4,rotationX:90,transformOrigin:"50%50%",ease:"ease",stger:0.04});splitTextTimeline.set(targetSlogan,{autoAlpha:0,display:"none",delay:1.5});});constmainBanner=document.querySelector(".main-banner"),buttonBanner=mainBanner.querySelector(".banner-link-button"),buttonClose=mainBanner.querySelector(".close");if(buttonBanner!=null){buttonBanner.addEventListener('click',()=>{if(mainBanner.classList.contains('hero-banner')){mainBanner.classList.remove('hero-banner');mainBanner.classList.add('marketing-banner');sendAnalyticsEvent("NewHeroMarketingBanner","Open");}else{mainBanner.classList.remove('marketing-banner');mainBanner.classList.add('hero-banner');}});}if(buttonClose!==undefined){buttonClose.addEventListener('click',()=>{mainBanner.classList.remove('marketing-banner');mainBanner.classList.add('hero-banner');});}});functionresizeHeroSection(){conststickyFooter=document.querySelector('.sticky-footer-wrapper'),mainHeader=document.querySelector('.main-header'),mainBanner=document.querySelector(".main-banner");letstickyFooterHeight=(typeof(stickyFooter)!=='undefined'&&stickyFooter!==null)?stickyFooter.offsetHeight:0,mainHeaderHeight=(typeof(mainHeader)!=='undefined'&&mainHeader!==null)?mainHeader.offsetHeight:0,calculatedHeight=stickyFooterHeight+mainHeaderHeight,c線上CFD交易 | 交易市場 | Plus500omposerVH=(typeof(visualViewport)!=='undefined')?window.visualViewport.height:window.innerHeight,doc=document.documentElement;doc.style.setProperty("--composer-vh",(composerVH-calculatedHeight)+"px");//heightsmalldevicesdetectionmainBanner.classList.toggle('sm-height',(composerVH-calculatedHeight){if(typeofresizeHeroSection==="function"){resizeHeroSection();}if(typeofwindow.visualViewport!=='undefined'){window.visualViewport.addEventListener("resize",resizeHeroSection);}else{window.addEventListener("resize",resizeHeroSection);}});window.addEventListener('load',(event)=>{vartl1=newTimelineMax({onComplete:function(){this.restart();}});tl1.fromTo(".item-anim1,.item-anim4",.5,{opacity:0,x:-50},{opacity:1,x:0}).to(".item-anim1,.item-anim4",.5,{opacity:0,x:50},"+=3").fromTo(".item-anim2,.item-anim5",.5,{opacity:0,x:50},{opacity:1,x:0},"-=.3").to(".item-anim2,.item-anim5",.5,{opacity:0,x:-50},"+=3").fromTo(".item-anim3,.item-anim4",.5,{opacity:0,x:-50},{opacity:1,x:0},"-=.3").to(".item-anim3,.item-anim4",.5,{opacity:0,x:50},"+=3").fromTo(".item-anim1,.item-anim5",.5,{opacity:0,x:50},{opacity:1,x:0},"-=.3").to(".item-anim1,.item-anim5",.5,{opacity:0,x:-50},"+=3").fromTo(".item-anim2,.item-anim4",.5,{opacity:0,x:-50},{opacity:1,x:0},"-=.3").to(".item-anim2,.item-anim4",.5,{opacity:0,x:50},"+=3").fromTo(".item-anim3,.item-anim5",.5,{opacity:0,x:50},{opacity:1,x:0},"-=.3").to(".item-anim3,.item-anim5",.5,{opacity:0,x:-50},"+=3")});window.addEventListener("load",function(){loadJS("cdn-main.plus500.com/1.0.0./Resources/Scripts/slick.min.js",document.body,function(){functionlazyLoadSlideBackgroundIme(backgroundImeWrapper){if(backgroundImeWrapper===null)return;if(backgroundImeWrapper.hasAttribute("data-background-ime")){backgroundImeWrapper.style.backgroundIme=`url(${backgroundImeWrapper.dataset.backgroundIme})`;backgroundImeWrapper.removeAttribute("data-background-ime");}}constseoSliderElem=$('#seoSlider');seoSliderElem.slick({arrows:false,centerMode:true,centerPadding:0,dots:true,infinite:false,speed:1000,rtl:false,slidesToScroll:1,slidesToShow:1,mobileFirst:true,responsive:[{breakpoint:1023,settings:{centerPadding:"5%",}},{breakpoint:1439,settings:{centerPadding:"20%",}},{breakpoint:2559,settings:{centerPadding:"30%",}},{breakpoint:3839,settings:{centerPadding:"35%",}}],});constseoSection=document.querySelector('[data-section-name="seo-carousel"]');constseoSliderElementsLength=seoSliderElem[0].slick.$slides.length;constseoSectionObserver=newIntersectionObserver((entries)=>{constcurrentSlide=seoSliderElem[0].slick.currentSlide;if(entries[0].isIntersecting){if(seoSliderElementsLength>0){lazyLoadSlideBackgroundIme(seoSliderElem[0].slick.$slides[currentSlide].querySelector("[data-background-ime]"));lazyLoadSlideBackgroundIme(seoSliderElem[0].slick.$slides[currentSlide+1].querySelector("[data-background-ime]"));}if(currentSlide===0){seoSliderElem.slick('slickGoTo',currentSlide+1);}if(currentSlide>0){seoSliderElem.slick('slickGoTo',currentSlide-1);}}});seoSectionObserver.observe(seoSection);seoSliderElem.on("beforeChange",(event,slick,currentSlide,nextSlide)=>{if((nextSlide+1){constloadGlobalSearchJsFile=()=>{loadJS("cdn-main.plus500.com/1.0.0./Resources/Scripts/globalSearch.min.js",document.body,function()線上CFD交易 | 交易市場 | Plus500{searchApp=initSearch(searchOptions);searchElem=newFoundation.Dropdown($(searchOptions.rootElement),{parentClass:"header-search-wrapper",closeOnClick:"true",position:"bottom",alignment:"right"});searchElem.$element.on("hide.zf.dropdown",()=>{searchButton.classList.remove("is-open");});});};loadJS("cdn-main.plus500.com/1.0.0./Resources/Scripts/vue.min.js",document.body,loadGlobalSearchJsFile);searchButton.removeEventListener("mouseover",loadAndInitGlobalSearch);searchButton.removeEventListener("touchstart",loadAndInitGlobalSearch);};window.addEventListener("load",()=>{constmobileMenuTrigger=document.querySelector(".mobile-menu-trigger");constmainMenu=document.querySelector(".main-menu>ul");if(searchButton){searchButton.addEventListener("mouseover",loadAndInitGlobalSearch);searchButton.addEventListener("touchstart",loadAndInitGlobalSearch);searchButton.addEventListener("click",(e)=>{e.currentTarget.classList.toggle("is-open");mobileMenuTrigger.classList.remove("is-open");mainMenu.dataset.height='0';mainMenu.style.height=0;mainMenu.classList.remove("open","drill-down");if(mainMenu.classList.contains("open")){mainMenu.classList.remove("open");}});}mobileMenuTrigger.addEventListener("click",(e)=>{e.currentTarget.classList.toggle("is-open");if(searchElem){searchElem.$element.foundation("close");}});varheaderTradingItem=document.querySelector(".start-trading-link");if(headerTradingItem!=null){headerTradingItem.addEventListener('click',function(){sendAnalyticsEvent("NewHeaderClick","StartTrading");});}document.querySelectorAll(".main-menua[data-pe]").forEach(el=>{el.addEventListener('click',()=>{letpeName=el.dataset.pe;letmenuCategory=el.closest("ul").dataset.menuName;sendAnalyticsEvent("HeaderMenuClick",menuCategory,peName);});});document.querySelector(".main-menu").addEventListener("mouseover",(e)=>{if(searchElem&&e.target.getAttribute("aria-haspopup")&&searchButton.classList.contains("is-open")){searchElem.$element.foundation("close");}});if(document.body.classList.contains("blue-header")){window.addEventListener("scroll",(e)=>{if(e.currentTarget.scrollY>0){document.body.classList.remove("blue-header");}else{document.body.classList.add("blue-header");}},{passive:true})}});window.addEventListener("DOMContentLoaded",()=>{constrwContainer=document.querySelector(".rw-container");constmainHeader=document.querySelector(".main-header");functionstickyRiskWarningHeight(init){mainHeader.classList.remove("rw-collapsed","rw-collapsible");mainHeader.classList.add(init?"rw-collapsed":"rw-collapsible");if(typeofresizeHeroSection==="function"){resizeHeroSection();}}rwContainer.addEventListener("click",(e)=>{if(e.currentTarget.closest('.rw-collapsed')){KeyValueStore.remove("_uk_riskwarning_hidden_");stickyRiskWarningHeight(false);}else{KeyValueStore.set("_uk_riskwarning_hidden_",true);stickyRiskWarningHeight(true);}});//Init-Checkrwcookiestatus//TODO:bindthestatetotheclassandbuttontooidlayoutshiftif(KeyValueStore.get("_uk_riskwarning_hidden_",false)==null){stickyRiskWarningHeight(false);}else{stickyRiskWarningHeight(true);}});window.addEventListener('load',()=>{loadJS("cdn-main.plus500.com/1.0.0./Resources/Scripts/support-button-on-scroll.min.js",document.body,()=>{initializeSupportButton();});});document.addEventListener("DOMContentLoaded",()=>{constcookieBannerWrapper=document.querySelector(".sticky-cookie-wrapper");if(localStore.getItem("_cookies_use_")){cookieBannerWrapper.remove();}else{cookieBannerWrapper.classList.remove("hide");}loadJS("cdn-main.plus500.com/1.0.0./Resources/Scripts/user-cookies-maner.js",document.body,()=>{cookieBannerWrapper.querySelector("#cookie-banner-accept-button").addEventListener('click',()=>{UserCookiesManer.onCookiesBannerAccept()cookieBannerWrapper.classList.add("cookie-out");cookieBannerWrapper.addEventListener線上CFD交易 | 交易市場 | Plus500("transitionend",()=>{if(typeofresizeHeroSection==="function"){resizeHeroSection();}cookieBannerWrapper.remove();});});if(!UserCookiesManer.isAcceptedCookies()){sendAnalyticsEvent('UserCookies','ShowBannerUnique')}})});functioncheckGaLoaded(){if(typeofga==='function'){sendAnalyticsEvent("ExperimentAllocation","AaExperiment","A","");}else{setTimeout(checkGaLoaded,500);}}checkGaLoaded();$(function(){varlazyImes=document.querySelectorAll("img.lazyload");if('loading'inHTMLImeElement.prototype){lazyImes.forEach(function(elem){elem.classList.remove("lazyload");if(elem.dataset.src){elem.removeAttribute("data-src");}if(elem.dataset.srcset){elem.removeAttribute("data-srcset");}});}else{$.each(lazyImes,function(i,el){//IE11dosen'tsupportforEach,usejQueryalternativeif(el.src){el.removeAttribute("src");}if(el.srcset){el.removeAttribute("srcset");}});//lazyImes.forEach(function(elem){//if(elem.src){elem.removeAttribute("src");}//if(elem.srcset){elem.removeAttribute("srcset");}//});}loadJS("cdn-main.plus500.com/1.0.0./Resources/Scripts/lazysizes.min.js",document.body)});

Tovuti:線上CFD交易 | 交易市場 | Plus500Ripoti

Ikiwa kuna ukiukaji wa wavuti, tafadhali bonyeza RipotiRipoti

Habari iliyopendekezwa

Tovuti iliyopendekezwa